PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF027700010CFD_t1
Common NameTRAES_3BF027700010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 552aa    MW: 59830.4 Da    PI: 4.9627
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF027700010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-164390148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  TRAES3BF027700010CFD_t1 43 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 90
                             79******************************************9986 PP

2Myb_DNA-binding521.6e-1696139146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  TRAES3BF027700010CFD_t1  96 KGAFTPEEERLIIQLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 139
                              799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016936.5E-2561552IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.6253890IPR017930Myb domain
SuperFamilySSF466893.71E-3140137IPR009057Homeodomain-like
SMARTSM007172.1E-144292IPR001005SANT/Myb domain
PfamPF002491.1E-144390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-234497IPR009057Homeodomain-like
CDDcd001672.68E-114590No hitNo description
PROSITE profilePS5129425.48291145IPR017930Myb domain
SMARTSM007173.4E-1795143IPR001005SANT/Myb domain
PfamPF002491.3E-1596139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2698143IPR009057Homeodomain-like
CDDcd001671.25E-1298139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0009908Biological Processflower development
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MYRVKSESDC EMMHQEDQMD SPVGDDGSSG GSPHRGGGPP LKKGPWTSAE DAILVDYVKK  60
HGEGNWNAVQ KNTGLFRCGK SCRLRWANHL RPNLKKGAFT PEEERLIIQL HSKMGNKWAR  120
MAAHLPGRTD NEIKNYWNTR IKRCQRAGLP IYPASVCNQS SNEDQGSSDF NCGENLSSDL  180
LNGNGLYLPD FTCDNFIANS EALSYAPQLS AVSISSLLGQ SFASKNCGFM DQVNQAGMLK  240
QSDHLLPGLS DTINGALSSV DQFPNDSEKL KKALGFDYLH EANSSSKTIA PFGGALTGSH  300
AFLNGTFSTS RTINGPLKME LPSLQDTESD PNSWLKYTVA PAMQPTELVD PYLQSPTATP  360
SVKSECASPR NSGLLEELLH EAQGLRSGRN QQLSVRSSSS SVSTPCDTTV ISPEFDLCQE  420
YWEERLNEYA APFSGNSLTG STAPVSAASP DVFQLSKLSP AQSPSLGSGE QAMEPAYEPG  480
AGDTSSHPEN FRPDAFFSGN TTDSSVFNNA IAMLLGNDMN TDCKPVFGHG IVFDTSPWSN  540
MPHACQMSEE FK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33371431106B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. {ECO:0000256|PIRNR:PIRNR001693}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519170.0JF951917.1 Triticum aestivum clone TaMYB34 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564452.10.0PREDICTED: transcription factor GAMYB-like
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLG9DR800.0G9DR80_WHEAT; Transcription factor
STRINGBRADI2G53010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-82myb domain protein 33
Publications ? help Back to Top
  1. Zhang L,Zhao G,Jia J,Liu X,Kong X
    Molecular characterization of 60 isolated wheat MYB genes and analysis of their expression during abiotic stress.
    J. Exp. Bot., 2012. 63(1): p. 203-14
    [PMID:21934119]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]